SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|251787832|ref|YP_003002553.1| from Dickeya zeae Ech1591

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|251787832|ref|YP_003002553.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 2.27e-41
Family Frataxin-like 0.00000714
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|251787832|ref|YP_003002553.1|
Sequence length 106
Comment iron donor protein CyaY [Dickeya zeae Ech1591]
Sequence
MNDSEFHQLADTLMLKIEETLDQFDGDADIDYETNGGVMTLSFENGSKIVINRQEPMHQV
WLAAKSGGYHFDYQNNRWICDRSGSDFMTLLAQACSEQSGEEIHFD
Download sequence
Identical sequences C6CGK4
561229.Dd1591_0181 WP_012767964.1.7237 WP_012767964.1.76531 WP_012767964.1.79317 gi|251787832|ref|YP_003002553.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]