SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|251788684|ref|YP_003003405.1| from Dickeya zeae Ech1591

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|251788684|ref|YP_003003405.1|
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.12e-32
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|251788684|ref|YP_003003405.1|
Sequence length 105
Comment phosphotransferase system PTS lactose/cellobiose-specific IIA subunit [Dickeya zeae Ech1591]
Sequence
MDMESTVMELIINAGEARSCAMQALRAAKQGDWAEVDAQLAESFAASKRAHDVQTMLIGM
DEGCGKIPVNLVMVHAQDHIMTSMLAREMVEELISIHRQLQAKSA
Download sequence
Identical sequences C6CNK5
WP_012768804.1.7237 WP_012768804.1.79317 561229.Dd1591_1054 gi|251788684|ref|YP_003003405.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]