SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|251789979|ref|YP_003004700.1| from Dickeya zeae Ech1591

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|251789979|ref|YP_003004700.1|
Domain Number 1 Region: 1-248
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.01e-71
Family Phosphate binding protein-like 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|251789979|ref|YP_003004700.1|
Sequence length 249
Comment cationic amino acid ABC transporter periplasmic binding protein [Dickeya zeae Ech1591]
Sequence
MKKLILAALLAGTAFSSMTFNAMAAETIRFAASATYPPFESLDAGNQIVGFDIDLANALC
KQLQVTCSFTNQAFDSLIPALKFRRYDAVISGMDITPERSKQVAFTQPYYANSAIVIAQK
GKFHSLADLKGKRIGIENGTTHQKFLQEKHPEVTTVPYDSYQNALIDLKNGRLDGVFGDT
AVVNEWLKANPDLATVGEKVTDPAYFGIGLGIAVRPDNQALLEKLNSALNAIKANGTYKT
INDKWFPQQ
Download sequence
Identical sequences C6CKA6
561229.Dd1591_2380 WP_012770083.1.79317 gi|251789979|ref|YP_003004700.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]