SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|251790533|ref|YP_003005254.1| from Dickeya zeae Ech1591

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|251790533|ref|YP_003005254.1|
Domain Number 1 Region: 4-270
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.58e-62
Family Phosphate binding protein-like 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|251790533|ref|YP_003005254.1|
Sequence length 297
Comment extracellular solute-binding protein family 3 [Dickeya zeae Ech1591]
Sequence
MQLRKLALSLLLISATGSLAHAEELTGTLKKVKDNGVIVIGHRESSVPFSYYDNQQKVVG
YSQAYSDKIVEAVRKKLDAPNLQVKLIPITSQNRIPLLQNGTYDLECGSTTNNLERQQQV
AFSDTIFIIGTRLLTKKDSGLKDFSELTGKAVVVTSGTTSEVLLNKMNEEKKLNLRIISA
KDHGDSFRTLESGRAVAFMMDDALLAGERAKAKTPDEWVITGTPQSREAYGCMLRKDDPQ
FKQLVDATISQLQTSGEAEKWFDTWFKQPIPPKNLNMNFELSDDMKALFKAPNDKAL
Download sequence
Identical sequences C6CPX4
gi|251790533|ref|YP_003005254.1| 561229.Dd1591_2953 WP_012770628.1.79317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]