SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225620061|ref|YP_002721318.1| from Brachyspira hyodysenteriae WA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225620061|ref|YP_002721318.1|
Domain Number 1 Region: 291-587
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 7.98e-77
Family DNA repair protein MutS, domain III 0.00000698
Further Details:      
 
Domain Number 2 Region: 590-823
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.54e-59
Family ABC transporter ATPase domain-like 0.000000606
Further Details:      
 
Domain Number 3 Region: 12-119
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 2.62e-43
Family DNA repair protein MutS, domain I 0.0000255
Further Details:      
 
Domain Number 4 Region: 118-290
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 4.19e-30
Family DNA repair protein MutS, domain II 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225620061|ref|YP_002721318.1|
Sequence length 887
Comment DNA mismatch repair protein MutS [Brachyspira hyodysenteriae WA1]
Sequence
MQETFFRSEKEENQKLTPMMRQYKEIKDKYSDSILLFRMGDFYEVFFDDAKIVSDILGLT
LTKRANVPMAGVPYHAIDNYLSKLVKSGMKIAICDQMEDPKTAKGIVKREVTQVITPGTI
SENKYLESKSNNYLASVIVSKSEKNAALSICDISTGELYATEINSNLENHNEALKEIINE
LTEEIIRFSPKEIMTIESVSESIIIKEIQNKFNNIFYSTTPNYTAEYSYAYKTLTNHFKT
VSLKSFGIEEKPLLISLLGSTIFYIQELSKTSLEHISNIKLYNRRDSMTLDYATIASLEI
LETIRNDNNKMTLFDTIDRTKTSMGARYLKRIIVEPLLNIEEINKRLNNVEFFYKNQKFM
YKIRDLLQDIGDIERLASKLALGRINPKELVSLKRFLVGSLEVVTELAMNNFEDVNFEEV
NDIKIITDLIERAILEDPKVVINEGDIIKDDYDETLKKYNEARREGRSWISELEYNYKQD
TGINNLKIRYNNVIGYYVEVTKSNVSSVPSDFIKRQTLIGSERYTTSKLMEYETIINEAN
EKSYALEYDIFINVRNKTNEYLNSILKMARVISIIDVYSSLACLAKEDNYIKPIITDDGI
IDIKDGRHPVVEVNLKTESFIPNDTYLDNKNEHMLIITGPNMSGKSTYLRQTALIVLLAQ
IGSFVPASSAKISIVDRIFTRVGASDNIARGESTFLVEMNETAYILNHCTDKSLVIMDEI
GRGTSTYDGLSIAWAIVEYLVHEENKKAKTLFATHYHELTMLEDLEGVKNYKVLVEEYKD
EIIFMKKVTEGAAKSSYGIYAAKIAGAPNKVIKRATEILKRLEADASVQVENIELNTQKS
KDILPLYDEPKIIEKESEIEKEIKDLNINTITPLDAMNLINKWKSMI
Download sequence
Identical sequences C0R0H6
WP_012670661.1.28499 WP_012670661.1.44798 WP_012670661.1.45318 WP_012670661.1.67878 565034.BHWA1_01134 gi|225620061|ref|YP_002721318.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]