SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225621073|ref|YP_002722331.1| from Brachyspira hyodysenteriae WA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225621073|ref|YP_002722331.1|
Domain Number 1 Region: 196-386
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.05e-53
Family Methylesterase CheB, C-terminal domain 0.0000206
Further Details:      
 
Domain Number 2 Region: 5-121
Classification Level Classification E-value
Superfamily CheY-like 4.41e-20
Family CheY-related 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225621073|ref|YP_002722331.1|
Sequence length 389
Comment chemotaxis response regulator [Brachyspira hyodysenteriae WA1]
Sequence
MLGAIRVLIAEDSKATSALLNNVLANHYRIEVVSIVNNGIDAYKSIVAIKPDFVVMNIDL
PLMGGIELLKLLKKENIQTNILVMSSLAQNKDLSSRALDLGALDIIYKPRNINADFIRDN
ILNIILETTKNNPIKCDLAFDYNASILNSCSIKEEIEDDEKTYMDKFDDNVRIMPYDQKQ
VATALSKTFRKDFKAPILVAIGISTGGPRALRIMLPSLPKDFPLPILISQHIPKEFSSSL
ISSLQDISKIKIKEAQVDEEILPSIVYISPGDKNMGIYMDSKGKLRIKFYPDPDKKFVYT
PCVDYLFNTIDDVLKDKAIAIVMTGMGNDGTSGMTRLYNDNNLTIAQDKASCTVYGMPRS
VIENKVVHLVLSLYDIAEFLVQYLRGKLK
Download sequence
Identical sequences A0A193F7N4 C0QW41
565034.BHWA1_02169 WP_012671660.1.11734 WP_012671660.1.24165 WP_012671660.1.24451 WP_012671660.1.28499 WP_012671660.1.37874 WP_012671660.1.38209 WP_012671660.1.44798 WP_012671660.1.45318 WP_012671660.1.54887 WP_012671660.1.54899 WP_012671660.1.64247 WP_012671660.1.64884 WP_012671660.1.67878 WP_012671660.1.68144 WP_012671660.1.68614 WP_012671660.1.75576 WP_012671660.1.75702 WP_012671660.1.85211 WP_012671660.1.88305 WP_012671660.1.89179 WP_012671660.1.95116 WP_012671660.1.95541 WP_012671660.1.9677 gi|225621073|ref|YP_002722331.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]