SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|225620344|ref|YP_002721601.1| from Brachyspira hyodysenteriae WA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225620344|ref|YP_002721601.1|
Domain Number 1 Region: 94-292
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 1.78e-17
Family Glucose permease-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|225620344|ref|YP_002721601.1|
Sequence length 299
Comment Peptidase [Brachyspira hyodysenteriae WA1]
Sequence
MYIKPKKKKNNNKYINKKENFFHLFFHKIGKFLTHRIYFMFIPHSKKKTKTLSLPIYSII
IIVLIISLSLLTTFSFLTKNTVLASKTEVLSGSYKDKLTEINSLENIFSSVVSNDYYRSD
MSNIASILKVDTNNINFSSNYMDNILLMNLRAEELEKLKVYLDELKANITSKNNALEPIP
SILPIDSRYAVISRPYQDGSIISRGIGFETIAGTLIRATASGTVNDITYDKDTGFTITIY
HRFGIITRYSGLATSLVSEKMDVKKGEILGNAKTGVFEYELRIATEYVNPLIFTTVEYQ
Download sequence
Identical sequences A0A193F9Y9 C0R1A9
gi|225620344|ref|YP_002721601.1| WP_012670940.1.100804 WP_012670940.1.11734 WP_012670940.1.24165 WP_012670940.1.24451 WP_012670940.1.28499 WP_012670940.1.37874 WP_012670940.1.38209 WP_012670940.1.44798 WP_012670940.1.45318 WP_012670940.1.54887 WP_012670940.1.54899 WP_012670940.1.64247 WP_012670940.1.64884 WP_012670940.1.67878 WP_012670940.1.68422 WP_012670940.1.68614 WP_012670940.1.75576 WP_012670940.1.85211 WP_012670940.1.88305 WP_012670940.1.89179 WP_012670940.1.95116 WP_012670940.1.95541 WP_012670940.1.9677 565034.BHWA1_01423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]