SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Trici1|9060|gm1.9060_g from Trichoderma citrinoviride v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trici1|9060|gm1.9060_g
Domain Number 1 Region: 14-172
Classification Level Classification E-value
Superfamily CinA-like 5.1e-43
Family CinA-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trici1|9060|gm1.9060_g
Sequence length 173
Sequence
MDSDFQPDPRIGETAFHVATDLVEKLRNAGQTVGVAESLTAGAVCSTIASAMGASKVFRG
GCVAYGSELKEELLGVDKQLIAEKGVIHADVAKQMAEGARRITSLKDSETTWGIGTTGVA
GPDKQDDKPVGTVYIGIAGPNGTYSFGFAFPGTREQIIEATTVEALHRLRKSL
Download sequence
Identical sequences jgi|Trici1|9060|gm1.9060_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]