SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253825516|ref|YP_003038817.1| from Photorhabdus asymbiotica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253825516|ref|YP_003038817.1|
Domain Number 1 Region: 211-421
Classification Level Classification E-value
Superfamily Colicin 2.88e-54
Family Colicin 0.0000423
Further Details:      
 
Weak hits

Sequence:  gi|253825516|ref|YP_003038817.1|
Domain Number - Region: 167-216
Classification Level Classification E-value
Superfamily Lysozyme-like 0.00456
Family Phage lysozyme 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|253825516|ref|YP_003038817.1|
Sequence length 424
Comment putative colicin-like protein [Photorhabdus asymbiotica]
Sequence
MKDDLIMSIYKLDTLVVTPHNSFFNKFRGNSGIDSGELSYIQAINAYCSPFLNGEKSECP
VCGKINCPIFKKECDKLLNGQNNIDAKRNLMRGAYFGFPFLQIIEEYKKFENTYSNNLKA
NNIIPTVDVRKEMFKNYMDVAEICSRVPYQGRWSFINPARKGSELQFLPYSLTVALATLA
SDAGVDNIKNHSEMNEAMRKGDWDKAVKSFHAKMQYTETNVSVLNELIKEAERKKKSDEE
INAIKNAVSYMSGVNKTIAEQYGDKVAKIAKEMQGEVKGKKIRNYQQALEVFEKTKNNLN
KKVNAKDRAAIKKALETLDKHTLANNLKQMGKAFGIVGYSVQAINVYEKTKLGFETGNWS
PLFLELESIAAGYGASALVGVALSMSGIAAPSVLFFALLGATASYYLSADNMGKINNFIV
ESIN
Download sequence
Identical sequences C7BU82
gi|253825516|ref|YP_003038817.1|NC_012961 gi|253825516|ref|YP_003038817.1| 291112.PAU_p0005 WP_012776173.1.101450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]