SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|237808006|ref|YP_002892446.1| from Tolumonas auensis DSM 9187

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|237808006|ref|YP_002892446.1|
Domain Number - Region: 189-270
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 0.0471
Family Proline dehydrohenase domain of bifunctional PutA protein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|237808006|ref|YP_002892446.1|
Sequence length 429
Comment hypothetical protein Tola_1243 [Tolumonas auensis DSM 9187]
Sequence
MKAVIATLPVLLAMLSSGVLAEDFSFDASEYEKKTFEFNGYVEAKQEALRLQPERAAYTL
NYPDEAPRDWLYRSTGTLDLAGTLNLTNSVANLHGQAFYAQDAFTSSHEYDKIMDGGIRW
SPSSDLSLDIGKRVQRWGKGYAWNPVGFIERPKDPSDPQTVREGFNMLSLDWTKTREGII
RTITFTPVIIPTYDELNPDFGSEEYLNPAAKLYLLAWDTDIDLMWLGEGARAQSAGLDFS
RNLSTNLEIHGEWAHQYGVTQNYLLPSGNVTQGTKNSDSYLLGLRYLTEREITWIIEYFH
NGRGYSSSELDAYYEFIDTAISPDAATSLRQKARQLMQSGYSKANPGENYLYLRASASEP
FDWLYTTPAVTLISHLDDGSFQVTPEISYTGFSNIELRARAMLLSREQKTEFGEKLSRQR
FEIYARYIF
Download sequence
Identical sequences C4LE39
WP_012729459.1.45904 gi|237808006|ref|YP_002892446.1| 595494.Tola_1243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]