SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|237808511|ref|YP_002892951.1| from Tolumonas auensis DSM 9187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|237808511|ref|YP_002892951.1|
Domain Number 1 Region: 5-138
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 1.14e-47
Family Molybdopterin synthase subunit MoaE 0.0000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|237808511|ref|YP_002892951.1|
Sequence length 144
Comment molybdopterin biosynthesis MoaE protein [Tolumonas auensis DSM 9187]
Sequence
MTDKILVQQEDFDVAAEYARLSDNPETGAIVSFIGKVRNFNQNSDVTGLHLEHYPAMTQL
SLEKLVAEAHARWPIQSCTLIHRVGDLTINDQIVLILVASVHRKAAFAACEFLIDELKTS
APFWKKERLTDGSLRWVSPALSPI
Download sequence
Identical sequences C4LFJ8
gi|237808511|ref|YP_002892951.1| 595494.Tola_1755 WP_015878836.1.45904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]