SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238909178|ref|YP_002939645.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238909178|ref|YP_002939645.1|
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily N-(deoxy)ribosyltransferase-like 0.0000000000000143
Family N-deoxyribosyltransferase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238909178|ref|YP_002939645.1|
Sequence length 130
Comment hypothetical protein EUBELI_10074 [Eubacterium eligens ATCC 27750]
Sequence
MRVYIAGAMTGVFKYKEKFIEAEEYIRGLGHIVLNPSFLPEGLSDYYEINKAMIDQCDAI
YVLLNYENSKGTKKEIEYAESTGKQVIYQNSTEVRDQNGNSWSWVNRPLGYSDYPIGYGN
YWEYPWRRCW
Download sequence
Identical sequences C4Z5Z6
gi|238909178|ref|YP_002939645.1|NC_012782 gi|238909178|ref|YP_002939645.1| 515620.EUBELI_10074 WP_012744494.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]