SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238915981|ref|YP_002929498.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238915981|ref|YP_002929498.1|
Domain Number 1 Region: 402-635
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 4.71e-91
Family Type II DNA topoisomerase 0.00021
Further Details:      
 
Domain Number 2 Region: 10-221
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.83e-74
Family DNA gyrase/MutL, N-terminal domain 0.00000132
Further Details:      
 
Domain Number 3 Region: 229-399
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.9e-61
Family DNA gyrase/MutL, second domain 0.00000692
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238915981|ref|YP_002929498.1|
Sequence length 644
Comment DNA gyrase subunit B [Eubacterium eligens ATCC 27750]
Sequence
MADQNAEKNYGGDQIQVLEGLEAVRKRPGMYIGSTSGRGLHHLVYEIVDNAIDEALAGFC
THIEVMINKDNSITVIDNGRGVPVDINHKTGRPAIEVVYTVLHAGGKFGGGGYKVSGGLH
GVGASVVNALSEWLEVQVKRNGHIYQQRYERGKICYDLKIVGDCDIEDTGTQVTFLPDSE
IFQETTVFEFDILMHRLREMAFLTKGIKITLTDLREGLEQQKVFHYEGGIKEFVQYLNKS
KEPLYSQIIYCEGVKDNVQVEVAFQHNDGYNEVVDSFVNNIKTPEGGTHLTGFRNSLTKT
FNDYARKNKILKDSDQGLSGDDIREGLTAIVSVKIEDPQFEGQTKQKLGNTVARGAVDSI
VSEQLTYFLEQNPAVAKSICEKSLLAQRAREAARKARDLTRRKTALESTSLPGKLADCSD
KDPKNCEIYIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKARLDRILGNAEIKAMIT
AFGTGIHEDFDISKLRYHKIIIMTDADVDGAHIATLLLTFLYRFMPDLIREGHVYLAQPP
LYKVEKNKKVWYAYNDDELNAIMTEIGRDQNNKVQRYKGLGEMDAEQLWETTMDPHKRVL
LRVNMNEDDDSELDVTFSTLMGDKVEPRRDFIEANAKFVKNLDI
Download sequence
Identical sequences A0A1Q6PMZ1 C4Z177 R5ZUA3
WP_012738289.1.74791 gi|238915981|ref|YP_002929498.1| 515620.EUBELI_00005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]