SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238915988|ref|YP_002929505.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238915988|ref|YP_002929505.1|
Domain Number 1 Region: 4-196
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 9.56e-51
Family Galactoside acetyltransferase-like 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238915988|ref|YP_002929505.1|
Sequence length 201
Comment galactoside O-acetyltransferase [Eubacterium eligens ATCC 27750]
Sequence
MWNMTERQKMISGQLYKSGVKELVNDRMLCKEQCYDFNALRPSQTEEQTAMIKKIFGKVG
SNCFITAPFWCDYGYNIEAGDNFYANHNLIILDCAKVTFGNNVFIAPDCGFYTAGHPVDA
ASRNEGWEYAYPINVGNDVWIGGGVKVMPGVTIGNNVVIGGGSVVVKDIPDNSIAVGNPC
KVIKKIESGKAREYNIEEKHI
Download sequence
Identical sequences C4Z184
gi|238915988|ref|YP_002929505.1| WP_012738296.1.74791 515620.EUBELI_00012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]