SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916033|ref|YP_002929550.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916033|ref|YP_002929550.1|
Domain Number 1 Region: 32-156
Classification Level Classification E-value
Superfamily Nudix 9.07e-30
Family BT0354 N-terminal domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238916033|ref|YP_002929550.1|
Sequence length 230
Comment hypothetical protein EUBELI_00066 [Eubacterium eligens ATCC 27750]
Sequence
MKYLSEEQNKCFVGTGELNKAGDSLAVFLDKYDPDKYQNPCNTVDTLVFTKEDSQVKRIL
LIKRGNHPCIGLWACPGGFVEFKENLYDAALRELQEETGLHDIEAEQLKSYGDYDRDPRT
RIITTAFVALIDEGSQKAQAGDDAREAGWFDISDELVNKTEDKSLIKEEWLCRLSNADKN
INICARVEVTYRKGILKNRTYKVVDGDGLAADHAAIILEGYHHVKEAFNA
Download sequence
Identical sequences C4Z1C9
gi|238916033|ref|YP_002929550.1| 515620.EUBELI_00066 WP_012738341.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]