SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916042|ref|YP_002929559.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916042|ref|YP_002929559.1|
Domain Number 1 Region: 145-414
Classification Level Classification E-value
Superfamily Poly A polymerase C-terminal region-like 5.76e-50
Family Poly A polymerase C-terminal region-like 0.00047
Further Details:      
 
Domain Number 2 Region: 9-144
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.85e-39
Family Poly A polymerase head domain-like 0.0000482
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238916042|ref|YP_002929559.1|
Sequence length 417
Comment tRNA nucleotidyltransferase [Eubacterium eligens ATCC 27750]
Sequence
MPENFHIDMPEAVRNIIHTIEEHGFKAYAVGGCIRDSILGRNPDDWDITTSAVPSQIKTF
FKRTVDTGIAHGTVTIMIDKTGYEVTTYRIDGEYEDGRHPKSVEFSDRLVDDLCRRDFTI
NAMAYNDTDGFVDEFNGLDDLDAKIIRCVGEPELRFTEDALRMMRAIRFSAQLGFTIDEA
TWNAIKKLAPSISKISMERVHVELGKTLMSAHPDYVAQYSEAGLFEPILPVIDNSLKSRY
KRKILATLQHTPDNIYLRYAALFIASTPDEAAKTLRALKLDNKTVDTVSKLVKLSKIDIE
ETEPAVRTALNQYGRDFLPLWHELMMAVIQASEDITGISNPAKVKHLLTLKRLGTDILAR
GDCFTIKALDISGNDLIEYGLQGHEIGETLKSLLDIVIENPKLNDKATLIAMIEHIK
Download sequence
Identical sequences C4Z1D8
515620.EUBELI_00075 WP_012738350.1.74791 gi|238916042|ref|YP_002929559.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]