SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916058|ref|YP_002929575.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916058|ref|YP_002929575.1|
Domain Number 1 Region: 34-114,231-329
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.0000389
Family TAP-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238916058|ref|YP_002929575.1|
Sequence length 361
Comment hypothetical protein EUBELI_00091 [Eubacterium eligens ATCC 27750]
Sequence
MKKFKPIIRCVIFLAGLAAIMGVIDFACVQTGYVNYILRNVCAKDNGTDYDTVVIGASHA
RASSDPEQIDKNAGTYSINMAIPGETVKDSYYVLEETCRTNDIKTVILDIDYQYYFNPPK
EGFYTEQFIQCQMNWGSYVKWQYIYDNMNRMEIRNVFTRRQACDFTLTSMKENIKQKLSK
GYKDADIYSLDVDGGTYAGRGYFYIKPVSGELAGKELIKSWSVRSREQITGYPLKYIKKI
IKYCRDNDIDLIAVTSPITPSSVGTLHMENVHNTINNLLVENGIFYYDFNMARQDVLPRT
DSDFVDKEGHMNGEFAKEYSEFLGKVIKEHKQGTKDINRYFYSSYQEMYDTDAGLYGVVE
K
Download sequence
Identical sequences C4Z1F4
gi|238916058|ref|YP_002929575.1| WP_012738366.1.74791 515620.EUBELI_00091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]