SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916072|ref|YP_002929589.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916072|ref|YP_002929589.1|
Domain Number 1 Region: 188-446
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.0000000000000442
Family Alkaline phosphatase 0.063
Further Details:      
 
Weak hits

Sequence:  gi|238916072|ref|YP_002929589.1|
Domain Number - Region: 12-128
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0889
Family Glycerol-3-phosphate transporter 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238916072|ref|YP_002929589.1|
Sequence length 554
Comment hypothetical protein EUBELI_00105 [Eubacterium eligens ATCC 27750]
Sequence
MKKIKDKLITIYPQLIFLIVTFCIFMPASLFLGNLDEFAVGFTALIPLLIAASLITAAVV
ILIGLIVPKKICNIYAAVIFGGALAAYVQGNFLNPDFGVLNGRQIQWSQFRVNAIISTVV
WIVLIVVPAVVVCFKKDIMTKIMKWGSLFLSSIQIVTLVVLIVASKRTVDYSYVVTKNDE
FALSSQGNVVVFIVDTLDNDDAQNYVIDRYSEELKDFTYFDNMIGGGAPTALGVPLMLTG
YQYDTTQSLADYRKKAYEEGSLIQDMSDNGYDVKLYTSSEYLNGVNQEAVANTAGGQKYR
ISDKVQFFKNIYKMSAFYAFPQIIKQYFWFYGDDFAACQAPKNNNIIQYELDDSQLYADF
NNNGGITVDAGNKTFTLYHMVGAHAPYEMNEQCVDVGETETSLDKQIQGVFRYINEYMQQ
MKDKGVYDNSTVIITADHGGYRLYERPAVFVKMADTHNDVMQVNSDSVTFKNLYATYGKA
ALGQKSNYGNTLFDMDGVSQSRYHVAPWDVSKGMYPADEYLKNRDYSVFRIDGYAVNPQI
SVIKDEQQMKNINN
Download sequence
Identical sequences C4Z1G8
gi|238916072|ref|YP_002929589.1| WP_012738380.1.74791 515620.EUBELI_00105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]