SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916087|ref|YP_002929604.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916087|ref|YP_002929604.1|
Domain Number 1 Region: 26-102,215-312
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.00000568
Family TAP-like 0.07
Further Details:      
 
Weak hits

Sequence:  gi|238916087|ref|YP_002929604.1|
Domain Number - Region: 87-162
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 0.0451
Family ATP synthase (F1-ATPase), gamma subunit 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238916087|ref|YP_002929604.1|
Sequence length 340
Comment hypothetical protein EUBELI_00120 [Eubacterium eligens ATCC 27750]
Sequence
MAVIAGMILIMDYALVPSGYIRYIIHETNNAGSDDGYDNIIIGASHARSAINPVKLDEAG
VSDNAFNLAIPGETVTDSYYLLMESDRHNNVKRVIYDLDYQYWCNYAEREFEDCFIYTWL
PFSNVKLKYIADNLLTKDFRTVYSKRWAYEISPSAIMNNLKVKSSAAYRNYSMDAVEIHD
AGGPYAAKGFFYRDMKMDSLVPSDIVAWDESGISDKVLDSFEKTVQYCKKNNIELVCVTS
PITPTTSVNGYSEQAGAYFTRLCEEYGVEYYDFNLLTMDTLPRTDDDFFDEEGHMLGELA
DRYSDILASVLLDKCDKSTAFYGTYAQLELAVYENYVTKQ
Download sequence
Identical sequences C4Z1W7
515620.EUBELI_00120 gi|238916087|ref|YP_002929604.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]