SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916125|ref|YP_002929642.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916125|ref|YP_002929642.1|
Domain Number 1 Region: 3-158
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.44e-38
Family GHMP Kinase, N-terminal domain 0.00013
Further Details:      
 
Domain Number 2 Region: 164-281
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.29e-25
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238916125|ref|YP_002929642.1|
Sequence length 288
Comment 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Eubacterium eligens ATCC 27750]
Sequence
MESIRLKARAKINLGLDVIGRRENGYHDVRMVMQTVGLYDRIIMTRIPEEEIRIKTNIGF
LPVNENNLVYKAIMLMKNKYKLDGGIEVDLNKFIPVAAGMAGGSSDAACALFGMNRLFEL
NVPMRELMKLGVEIGADVPYCLMRGTALAEGIGEKLTRLPDMPFCHILIAKPPVNVSTKL
VYEKLDNTDVKLHPDIDGIIEAIKLKDVALVASRMGNVLESVTIPLYPVIDSIKKDMIEH
GAINAMMSGSGPTVFGIFPDEQSMIACQQFLRQKGEARQVYTTETFTP
Download sequence
Identical sequences C4Z205
515620.EUBELI_00159 WP_012738433.1.74791 gi|238916125|ref|YP_002929642.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]