SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916198|ref|YP_002929715.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916198|ref|YP_002929715.1|
Domain Number 1 Region: 143-363,435-493,530-640
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.00000000183
Family Phase 1 flagellin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238916198|ref|YP_002929715.1|
Sequence length 646
Comment flagellar hook-associated protein 1 FlgK [Eubacterium eligens ATCC 27750]
Sequence
MANGMAGLFIGTTGLKTAQTALNTTAHNLSNINTSGYTRQQVTFSDTQYVRVNTSDKVSS
PDYGLGVAVSEVRRIRDQFIDQAYRNENSRLGFYESQYKAIEEIEDQFGEMQGVTYESYL
INLYNSVNELAKNPTSTVARSSLIQNATAFIEKSENVYKGLKDYQTTLNTQVKNMVDSIN
KLGDKIYTLNKKISKIESTGIEDANDLRDERDAAIDELSKYIDITYYENDSKEVVISAEG
IPFITMGELAKMDTRVVEGTNLVIPTWPGYERDVYDLSTEASNVDDTDKGELKGLLIARG
NMVVDYTVVPEAPSSSDYDMSTADGRAAYQEAYNKYYKAQEYYNTYIEPSAILSAMAGFD
KLVNGIVEKINNILCPEKSEVRNNPYMAPDGTEIQADIYTYNSVSQQVLFDRYGREVTGT
DNGDGTYSFSSGEKLYMSFGGAEVPVDSYTYSMLDMDKTGYGMDDDKTVGTELFSRKGTD
RYIKTTDDSGKTIYIRNNLNETDYESLYKLGNLQINPEAAQNVGKIPLSTVQGKEDFDRA
KELVDAWDEKFASLNPDTYAKSDFMTFYNNFIGEYATLGKALGNYVSNQTTMVDGYDNQR
LQSEGVSSDEELEKMIKYQQAYNAASRYVNVVNQMLEHLVTSLGNA
Download sequence
Identical sequences C4Z278
gi|238916198|ref|YP_002929715.1| 515620.EUBELI_00232 WP_012738505.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]