SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916200|ref|YP_002929717.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916200|ref|YP_002929717.1|
Domain Number 1 Region: 1-324,392-518
Classification Level Classification E-value
Superfamily Phase 1 flagellin 1.44e-45
Family Phase 1 flagellin 0.0036
Further Details:      
 
Weak hits

Sequence:  gi|238916200|ref|YP_002929717.1|
Domain Number - Region: 299-390
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0811
Family Capz alpha-1 subunit 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238916200|ref|YP_002929717.1|
Sequence length 518
Comment flagellar hook-associated protein 3 FlgL [Eubacterium eligens ATCC 27750]
Sequence
MRITNQMMINSSISNIQVNKNQINTLSTELSTQKKISKPSDDPIIAIRALRLRSSLDEVT
QYLGKNIPDASSWLSVTHDALDESNSIIKDLYKYCVQGSTDSYSESERNTLAESLNKLVE
AYYEQGNVDYAGRYVFTGHATDRPLTYQSDADAKNVDYSITQNFTREDLSTKTAYTNAYS
NDDILNLTVKTDANGNIITPNIQSVNRIQLAYDEINGGTFTLGMGNNNSANVTINADGTV
TMNGSLTADITQADGSVVQNQVSVVTTSDPDYIPGDNEIAINATTGELLLGQNVYQSVYQ
NNEFSVTYEKSNFIKGDIDPTMYFDCVDNNTGVVYDKKSEDIEYIVNFSQKLKVNTEADE
AFNIYLGRNVNDLVNTVQNVLDIDAQISKVESMQKDSQYSDDASQEKLKTIMEGLTKQRD
FAKSEMKNAFEAGIGQMQGYMDQVSNAKADVGNRQIRLDLTKTRLTEQKTNFTDLKSQNE
DIDLEEIVVTYTSAELVYQAALSAASKVVQQSLLDFLR
Download sequence
Identical sequences C4Z280
WP_012738507.1.74791 gi|238916200|ref|YP_002929717.1| 515620.EUBELI_00234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]