SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916244|ref|YP_002929761.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916244|ref|YP_002929761.1|
Domain Number 1 Region: 4-112
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 2.75e-41
Family N-utilization substance G protein NusG, N-terminal domain 0.0000353
Further Details:      
 
Domain Number 2 Region: 109-178
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000000000000284
Family N-utilization substance G protein NusG, C-terminal domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238916244|ref|YP_002929761.1|
Sequence length 178
Comment transcriptional antiterminator NusG [Eubacterium eligens ATCC 27750]
Sequence
MDDAKWYVVHTYSGYENKVKANIEKTVENRNLHDQILEVIVPLETVVEIKDGSKKAAQKK
MFPGYVLVKMVMNDDSWYVVRNTRGVTGFVGPGSKPVPLTPTEIKNLGISLEEEQEVKPV
IQFAGKVGDKVMILSGAWEDTVGEITNINEGKQCLTINVEMFGRETPVEIDFTDVKLL
Download sequence
Identical sequences A0A174Z155 C4Z2Q9 R6A4B8
WP_012738551.1.40640 WP_012738551.1.74791 WP_012738551.1.89035 515620.EUBELI_00278 gi|238916244|ref|YP_002929761.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]