SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916251|ref|YP_002929768.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916251|ref|YP_002929768.1|
Domain Number 1 Region: 16-151
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.57e-46
Family Cold shock DNA-binding domain-like 0.00000456
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238916251|ref|YP_002929768.1|
Sequence length 153
Comment 30S ribosomal protein S12 [Eubacterium eligens ATCC 27750]
Sequence
MQPFIILISGGENGMPTFNQLVKQGRKTAVKKSTAPALQKGYNSLQKKATDISSPQKRGV
CTAVKTATPKKPNSALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGT
RYHIIRGTLDTAGVAKRRQARSKYGAKRPKDAK
Download sequence
Identical sequences C4Z2R6
gi|238916251|ref|YP_002929768.1| 515620.EUBELI_00285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]