SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916253|ref|YP_002929770.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916253|ref|YP_002929770.1|
Domain Number 1 Region: 6-292
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.83e-106
Family G proteins 0.0000000217
Further Details:      
 
Domain Number 2 Region: 276-414
Classification Level Classification E-value
Superfamily Translation proteins 8.72e-36
Family Elongation factors 0.0000713
Further Details:      
 
Domain Number 3 Region: 489-626
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.03e-35
Family Translational machinery components 0.0000175
Further Details:      
 
Domain Number 4 Region: 630-716
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.01e-30
Family EF-G/eEF-2 domains III and V 0.0000445
Further Details:      
 
Domain Number 5 Region: 412-490
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.19e-24
Family EF-G/eEF-2 domains III and V 0.0000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238916253|ref|YP_002929770.1|
Sequence length 720
Comment elongation factor G [Eubacterium eligens ATCC 27750]
Sequence
MAGREYPLERTRNIGIMAHIDAGKTTLTERILYYTGVNHKIGDTHEGTATMDWMAQEQER
GITITSAATTCHWTPEKEGKPDKTQPEYRINIIDTPGHVDFTVEVERSLRVLDGAVGVFD
AQNGVEPQSENVWRQADKYNVPRMAFMNKMDKMGADFFGSCNQLITKLGKNPVLVQIPIG
KEDDFKGIIDLFEMKAYVFNGDKGDDIAVGEIPDDLKDQAQEYHDKLVEQCAELDEDLME
KFFNDEEISVPELKAALRKGTIEGTAIPCLCGTAYKNKGVQKLLDAVIEYMPAPTDIPDI
TGVDEDGNEVTRKSSDEEPFAALAFKIMTDPFVGKLAFFRVYSGTLNGGSYVLNSNKNKK
ERVGRILQMHANQRKEIDKVYSGDIAAAVGLKVTVTGDTICDEAHPVILESMEFPEPVIE
LAIEPKTKNDQGKMGEALAKLAEEDPTFRAHTDQETGQTIIAGMGELHLDIIVDRLLREF
KVEANVGAPQVAYRECFTKAVDVDSKYAKQSGGRGQYGHCKVRFSPLEANVDKFDVETKN
TVLINEPPVLFCESSVVGGAIPKEYIPSVADGIREAANSGILAGFPVLGLRADIYDGSYH
EVDSSEMAFHIAGSMAFKDAMAKAAPALLEPIMKVEVTMPEEYMGDVIGDINSRRGRIEG
MEDISGGKMIKAFVPLAEMFGYATDLRSKTQGRGNYSMFFDKYEQAPKSVQDKVISDRNK
Download sequence
Identical sequences C4Z2R8
WP_012738560.1.74791 515620.EUBELI_00287 gi|238916253|ref|YP_002929770.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]