SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916268|ref|YP_002929785.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916268|ref|YP_002929785.1|
Domain Number 1 Region: 111-258
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 5.9e-62
Family C-terminal domain of ribosomal protein L2 0.00000287
Further Details:      
 
Domain Number 2 Region: 2-109
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.84e-40
Family Cold shock DNA-binding domain-like 0.000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238916268|ref|YP_002929785.1|
Sequence length 265
Comment 50S ribosomal protein L2 [Eubacterium eligens ATCC 27750]
Sequence
MTGSDFSEITKSTPEKSLLAKKSKNAGRNNQGKITVRHHGGGNRQKYRMIDFKRNKEGVP
AQVIGIEYDPNRTANIALICYADGEKAYILAPQGLTDGMTVQNGAGAEVRVGNCLPLSEI
PVGTQVHNIELYPGKGGQLVRSAGNSAQLMAKEGKYATLRLPSGEMRMVPIICRATIGVV
GNGDHNLINLGKAGRKRHMGIRPTVRGSVMNPNDHPHGGGEGRAPVGRPSPMTPWGKPAM
GLKTRKAKKASNKLIVRRRNGKAIK
Download sequence
Identical sequences C4Z2T3
515620.EUBELI_00302 gi|238916268|ref|YP_002929785.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]