SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916287|ref|YP_002929804.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916287|ref|YP_002929804.1|
Domain Number 1 Region: 6-65
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000019
Family SPT5 KOW domain-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238916287|ref|YP_002929804.1|
Sequence length 89
Comment hypothetical protein EUBELI_00321 [Eubacterium eligens ATCC 27750]
Sequence
MSDIKGYFASSKAGHDKGTVYMILESDDVYVYLSDGKLRPTDKLKKKKLKHVQLIKQKDS
DLAEKIEKNLFISNEEIKYAIKQIKTSAK
Download sequence
Identical sequences A0A174ZIS4 C4Z2V2 R5ZZ46
515620.EUBELI_00321 gi|238916287|ref|YP_002929804.1| WP_012738594.1.40640 WP_012738594.1.74791 WP_012738594.1.89035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]