SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916288|ref|YP_002929805.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916288|ref|YP_002929805.1|
Domain Number 1 Region: 1-70
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.3e-26
Family Cold shock DNA-binding domain-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238916288|ref|YP_002929805.1|
Sequence length 72
Comment translation initiation factor IF-1 [Eubacterium eligens ATCC 27750]
Sequence
MSKADVIEIEGKVVEKLPNAFFKVELENGHQILATISGKLRMNFIRILPGDKVTIELSPY
DLTKGRIIWRDK
Download sequence
Identical sequences A0A174YS69 A0A174YTZ0 A0A1I2C6V9 A0A1Q6P5L8 C4Z2V3 R5ZQ68 R6K0W8 R7N9U3
gi|238916288|ref|YP_002929805.1| WP_012738595.1.28113 WP_012738595.1.40640 WP_012738595.1.55901 WP_012738595.1.74791 WP_012738595.1.86341 WP_012738595.1.89035 515620.EUBELI_00322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]