SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916299|ref|YP_002929816.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916299|ref|YP_002929816.1|
Domain Number 1 Region: 9-134
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.86e-49
Family Translational machinery components 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238916299|ref|YP_002929816.1|
Sequence length 134
Comment 30S ribosomal protein S9 [Eubacterium eligens ATCC 27750]
Sequence
MAKKANGKFYGTGRRKSSIARVYLVPGTGNITINKRSLDEYFGLETLKVVVKQPLALTET
ADKFDVIVNVHGGGYTGQAGAIRHGISRALLQVDSDEYRPSLKKAGFLTRDPRMKERKKY
GLKAARRAPQFSKR
Download sequence
Identical sequences A0A174ZES9 C4Z2W4
gi|238916299|ref|YP_002929816.1| 515620.EUBELI_00333 WP_012738606.1.40640 WP_012738606.1.74791 WP_012738606.1.89035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]