SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916302|ref|YP_002929819.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916302|ref|YP_002929819.1|
Domain Number 1 Region: 17-154
Classification Level Classification E-value
Superfamily Regulatory protein AraC 2.09e-16
Family Regulatory protein AraC 0.017
Further Details:      
 
Domain Number 2 Region: 223-272
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000753
Family AraC type transcriptional activator 0.029
Further Details:      
 
Domain Number 3 Region: 170-221
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000112
Family AraC type transcriptional activator 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238916302|ref|YP_002929819.1|
Sequence length 273
Comment xylan 1,4-beta-xylosidase [Eubacterium eligens ATCC 27750]
Sequence
MYHFINDNFLTDIATVPPSYKMKHFHEHNKWELMFIYSGSCTLYVGDEIYMLNPGGLALI
SPDTAHMTTYLAGSDHTRYVLYFNNDELKWIADDSSLDIESIFHEHPVIHIPERRLDYIS
SIIQKISYEHNGVDSLSLSFIHSYFHELILFILRCQMYEDNVITKMDTGNELIQKVIEYI
IENYHNDITMAATAELFNMSESSLSKKFKAFTGFRFREYLINVRTHAAADLLVNTSLSIT
EIADKCGFADSNTMGGTFKKIMGEAPGSYRKSH
Download sequence
Identical sequences C4Z2W7
515620.EUBELI_00336 APC21125 WP_012738609.1.74791 gi|238916302|ref|YP_002929819.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]