SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916307|ref|YP_002929824.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|238916307|ref|YP_002929824.1|
Domain Number - Region: 47-228
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0379
Family Phase 1 flagellin 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238916307|ref|YP_002929824.1|
Sequence length 249
Comment hypothetical protein EUBELI_00341 [Eubacterium eligens ATCC 27750]
Sequence
MKKRIYLSIIYFITLICIIIGVLGNVFNISPFTRMTMASSGKYIENSSIYDNVSDISVDM
NLGSVEIKKGSKLEVIYTGAEKFKPAVSVSGTSLNIEQHVKVHLMTNIKNSDCTLTITIP
DNICLNSIQADLNMGDMDVNNIHASSADFSVDMGSLKIVDSAVKNLTADNNMGDIKLTNC
GSDALNLSVDMGSLKISGMDIDKYRANLSVDLGDIKVNDSTYSHSYTNNAGSGKSINADV
NMGDIKINR
Download sequence
Identical sequences C4Z2X2
515620.EUBELI_00341 gi|238916307|ref|YP_002929824.1| WP_012738614.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]