SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916369|ref|YP_002929886.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916369|ref|YP_002929886.1|
Domain Number 1 Region: 1-274,301-497
Classification Level Classification E-value
Superfamily Phase 1 flagellin 3.66e-98
Family Phase 1 flagellin 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238916369|ref|YP_002929886.1|
Sequence length 497
Comment flagellin [Eubacterium eligens ATCC 27750]
Sequence
MVVQHNMAAMNANRMLSGVSSAQSKSTEKLSSGYRINRAADDAAGLSISEKMRSQIRGLN
KASDNAQDGISLIQTAEGALNESHSILQRMRELSVQAANGTETDDDREAVQNEIEQLQSE
LTRISDTTEFNTMKLLDGSQSGSKVQASVSKSADAMLTTEPATTGKSVSAALTNTADGTE
STYAVTVMDKDGNASTTTVKFTAGADEEADANAIIKALKDTDLADKFDMTYATGDKTITF
TSKEEGVSSNVVLTQLGTAKAAAATVTPGTDAYSKLSKDYAAYDGSGNIEDAIFTVNGQK
FAYVTDATKLGDDYKDVNYIETAAATIDPAEAAKMAKLINSKTGISAEADKNGNISLKAG
SSNTGKGIELQIGANEGQTMSFTLDDMSADALGVGVGKVDLSKQETAKTATTTIDAAIKK
ISKARGQMGAVQNRLEHTINNLDTASENMQTAESRIRDTDMAEEMVNYSKNNILAQAGQS
MLAQANQSNQGVLTLLQ
Download sequence
Identical sequences C4Z3H0
515620.EUBELI_00422 WP_012738675.1.74791 gi|238916369|ref|YP_002929886.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]