SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916387|ref|YP_002929904.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916387|ref|YP_002929904.1|
Domain Number 1 Region: 2-79,162-300
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.53e-34
Family Rhamnogalacturonan acetylesterase 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238916387|ref|YP_002929904.1|
Sequence length 317
Comment carbohydrate esterase family 12 protein [Eubacterium eligens ATCC 27750]
Sequence
MNIYLAGDSIVQNYTEEEFIAGWGQFLPRFFKPDVNVFNYAKGGRSSRLFINEGRFEEID
RHIQSGDYLFIEFCHNDDDSKDYKSMFNRQTPLGVPDESGRFPVIAGVKMPKNYIPPEYI
EALNNDDSITDKQAVLNSVLAINQSYPYDTYYPYSKDASMGSYKWFIKQFIDMARKHDAV
PVLVTAPARTFFNDDGTIMDAPGCHGGNNFSYIRAMRQIGEETGTPVLDLFSYSVELFEK
IGHDNIHRYTSIKKGINKGKWPDDFLKELAKPETVSENTHFNKDGAMLITEGLVELIRES
KNPQLCELQSSLLHNVV
Download sequence
Identical sequences C4Z3I8
515620.EUBELI_00441 gi|238916387|ref|YP_002929904.1| WP_012738693.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]