SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916390|ref|YP_002929907.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916390|ref|YP_002929907.1|
Domain Number 1 Region: 114-298,420-580
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.46e-90
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000012
Further Details:      
 
Domain Number 2 Region: 295-415
Classification Level Classification E-value
Superfamily GAD domain-like 2.62e-30
Family GAD domain 0.0017
Further Details:      
 
Domain Number 3 Region: 5-102
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.07e-23
Family Anticodon-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238916390|ref|YP_002929907.1|
Sequence length 581
Comment aspartyl-tRNA synthetase [Eubacterium eligens ATCC 27750]
Sequence
MANMYRDVNLSEVNESYIGKELKVAGWVENIRDHGGVSFIDLRDMYGVLQVVLRDTTLLD
GIHKEECIAIEGIMEQRDEETYNPKIPSGTIELEAKKITILGQVYQQLPFEVQTSKEVRE
DVRLKYRYLDLRNQKVKDNMIFRSKVIAFLRQKMTDMGFLEIQTPILCASSPEGARDYIV
PSRKYKGKFYALPQAPQQYKQLLMVSGFDKYFQIAPCFRDEDARADRSPGEFYQLDFEMS
FATQEDVFRIGEEVLTETFAKFAPEGYEVTQAPYPIISYKQAMLEFGSDKPDLRNPLRII
DLSEFFNKCTFKPFQNKTVRAINVHAKLSKGQHEKLLKFATGIGMGGLGYLEVLEDGSYK
GPIDKFIPEELKGEIKDLAGLQPGDTIFFIADKEDRAAYFAGQIRNELGERLDLIEKNAY
RFCYVNDFPMFERDPETKKIGFTHNPFSMPQGGLEALNTKDPLDILAYQYDIVCNGVELS
SGAVRNHDMQIMVKAFEIAGYDEEVLKAKFGALYNAFQFGAPPHAGMAPGVDRMIMLLRN
EENIREIIPFPMSGTAQDLMCGAPNEVTEQQLREVHIKVRD
Download sequence
Identical sequences C4Z3J1
gi|238916390|ref|YP_002929907.1| 515620.EUBELI_00444 WP_012738696.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]