SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916400|ref|YP_002929917.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916400|ref|YP_002929917.1|
Domain Number 1 Region: 7-181
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.88e-39
Family HD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238916400|ref|YP_002929917.1|
Sequence length 198
Comment hydrolases of HD superfamily [Eubacterium eligens ATCC 27750]
Sequence
MDKDRLDRQIEFIREIDKEKSIGRQTYLADASRKEDDAEHAWHMAIMTVLLSEYANEKID
VLRTMTMLLIHDLVEIDAGDTYAYDENAKKTQRERELKCADRIFSILPEDQGKYMRELWE
EFEAQETPEAKFARTMDNFQPVILNDASKGKSWAEKGVHLSQILKRNARTGEGSEELWKY
SYEKFIMPNVKKGNIKED
Download sequence
Identical sequences A0A174YW16 C4Z3K1
gi|238916400|ref|YP_002929917.1| 515620.EUBELI_00454 WP_012738706.1.74791 WP_012738706.1.89035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]