SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916448|ref|YP_002929965.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916448|ref|YP_002929965.1|
Domain Number 1 Region: 243-485
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 5.89e-18
Family Arylsulfatase 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238916448|ref|YP_002929965.1|
Sequence length 665
Comment hypothetical protein EUBELI_00505 [Eubacterium eligens ATCC 27750]
Sequence
MNKVKTFLQKIWTYDLVHTAVYSLILELVVECFNRRGIMGLAFPFMHPVIFIYNTLIIMT
TMTIALFFTRRIFAYCVISVAWIGLSLTNFIILSSRKTPFTAMDFYLIKDAIKVAGLYVS
IVQIILIALLVIAVITGLVFLWRKAPKIEVTIKKTKFYAYAGVQLVLVFLAAYGIGITLL
FTGAVEGHFGNLAQAYKKYGFSHCFVSSVLDRGIKKSGEYSEEYMESLKKDLDDVEPEAD
DKTPNIIFVQLESFFDPTHVKGITLSENPLPNYQKLISEYSSGYLSVPCFGAGTCNTEFE
VQTGINIDDFGPGEYPYRTIMKSKVCESMAYDLKKLGYSTHAIHNNDGTFYDRNLVFSHL
GYDTFTSIEYMDGFEKTPMGWAKDYVLTDEIDKALNSTSGTDYVFTISVQGHGDYPSTPM
EGYTPEIKVTNFPVAEQQASFEYYVNQIHEMDNFIGELVDKLSERDEETILVLYGDHLPT
FDFTDEMLTNGDKFQTQYVIWSNFQMDKQNKDIQAYQLSAYVMERLGMSEGYIMKYHQSK
KNLPEDEYLKNLKILEYDILYGKKEIYGGDTPYVATELKMGIDDIEITDVYNYGDTVFIE
GNHFNDYSCALINGKEYATEKISDRLLRVKGAKVKKDDLVTVAQKGDDKVELSRTTFAVK
QQAKQ
Download sequence
Identical sequences C4Z3P9
WP_012738754.1.74791 515620.EUBELI_00505 gi|238916448|ref|YP_002929965.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]