SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916461|ref|YP_002929978.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916461|ref|YP_002929978.1|
Domain Number 1 Region: 106-277
Classification Level Classification E-value
Superfamily DNA-glycosylase 5.18e-39
Family DNA repair glycosylase, 2 C-terminal domains 0.0011
Further Details:      
 
Domain Number 2 Region: 9-105
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.3e-20
Family DNA repair glycosylase, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238916461|ref|YP_002929978.1|
Sequence length 287
Comment N-glycosylase/DNA lyase [Eubacterium eligens ATCC 27750]
Sequence
MADYKLKNVCDFDLAQTLECGQCFHFVKLDEEDYVLTAKGYVLHVSQEADTVTFYDTDKD
EYVNVWKDYFDMDRDYSAIKKKLLEKDDKLKDAIESMWGVRILNQDFFETLISFIISQNK
QIPHIKKIVADISAKFGTYKGTYGGADMYTFPTLEQLANASEEDFKELKTGFRAPYIMDA
IRRNMAGQFDINELKSMDYDSCIKELMTIKGVGEKVANCVSLFGLGKKEAFPVDVWIKRI
METMYFDGVDTPKDKIAAFAKEQFGELGGFAQQYLFYYGKSIKMGVK
Download sequence
Identical sequences C4Z3R2
WP_012738767.1.74791 gi|238916461|ref|YP_002929978.1| 515620.EUBELI_00518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]