SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916618|ref|YP_002930135.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916618|ref|YP_002930135.1|
Domain Number 1 Region: 27-332
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.85e-79
Family HD domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238916618|ref|YP_002930135.1|
Sequence length 335
Comment deoxyguanosinetriphosphate triphosphohydrolase-like protein [Eubacterium eligens ATCC 27750]
Sequence
MNIREEQEKREHLIFSPYASFSDESRGRDRDEEPCPMRTIYQRDRDRIIHCKTFRRLKHK
TQVFLAPEGDHYRTRLTHTLEVAQIARSIARALNLNEDLTEAIALGHDLGHTPFGHAGER
TLNSLCPMGFAHYKQSIRVVEFLEKDGQGLNLTWEVRDGILNHRTSGNPSTLEGKAVRLS
DKIAYINHDIDDGIRAGILKESDIPSEYTDVLGNSTKERLNTMISDIIMNSIGKNDLVMS
EPVHKAMTELRKFMFESLYLNPTAKSEEAKADKLITELYRYYVANTDKLPDTYKRFITEF
DERPEQVVCDYIAGMSDQYSISKFQEIFVPKAWKG
Download sequence
Identical sequences A0A1Q6PFN8 C4Z4Y4
WP_012738924.1.74791 515620.EUBELI_00675 gi|238916618|ref|YP_002930135.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]