SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916660|ref|YP_002930177.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916660|ref|YP_002930177.1|
Domain Number 1 Region: 66-294
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1e-55
Family G proteins 0.00001
Further Details:      
 
Domain Number 2 Region: 1-65
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000377
Family Cold shock DNA-binding domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238916660|ref|YP_002930177.1|
Sequence length 296
Comment GTPase EngC [Eubacterium eligens ATCC 27750]
Sequence
MQGKIIKGIAGFYYIHVEASGIYECKAKGIFRNRHIKPLVGDNVEIEVIDKDNFKGNVVD
ILPRKNELIRPASANIDQAMVIFAVKTPEPNFNLLDKFILMMNYQDVPTVVCFNKEELAD
DEYKNELKKKYEGCGCECIFISAKNNIGIDRIMEVLKGKTTVLAGPSGVGKSTLTNLLIP
DMEEQGEVSQTGEVSRIGRGRHTTRHSEIYNVCKETYICDTPGFTSLNLPDVEKEDLRFY
FEEFVPFEGKCRFNGCMHVSEPGCAVKQAVENGIINYDRYKSYTDIFEEIKNKKKY
Download sequence
Identical sequences C4Z526
WP_012738966.1.74791 515620.EUBELI_00722 gi|238916660|ref|YP_002930177.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]