SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916706|ref|YP_002930223.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916706|ref|YP_002930223.1|
Domain Number 1 Region: 231-591
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.55e-60
Family Amylase, catalytic domain 0.000000862
Further Details:      
 
Domain Number 2 Region: 124-225
Classification Level Classification E-value
Superfamily E set domains 1.1e-23
Family E-set domains of sugar-utilizing enzymes 0.00054
Further Details:      
 
Domain Number 3 Region: 597-696
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.22e-18
Family alpha-Amylases, C-terminal beta-sheet domain 0.00071
Further Details:      
 
Domain Number 4 Region: 22-112
Classification Level Classification E-value
Superfamily E set domains 0.000000000000332
Family E-set domains of sugar-utilizing enzymes 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238916706|ref|YP_002930223.1|
Sequence length 793
Comment glycoside hydrolase family 13 protein [Eubacterium eligens ATCC 27750]
Sequence
MNKNLYGLMNWPEIEGIVYAECDKPKELLGAHVTGKGLLIQIMRPDAVTVKLHIDGRKTA
VNMEKVDESGFFATLVSSKKKLSYTYSVEKVNGEVTEYTDPYAFANVTKPEDYKAFLAGE
EKNAAHIFGAHERTVNGVKGVLFTVWAPKALSVSVVGEFNKYDGRVHLMERIEDTGVFEL
FIPGLAAGCGYMYEIKRQGKGTTRKLDPVSRQISSVPITASMVSDENMPDSYAWNDGIWM
IKRKKEAGKKKPVTVYEVSLTDWLKEKSADEFVDFLKQEGYTHVCFLPVAEYLNEEMNGY
STLGYFAVTHRTGGSDAFKKLVDDCHNAGIGVIMDWNGAYFGTEVKGLYDFDGADAYGYL
KPSLEKHPEWDVVTFDYKKGAVRSFLLSSVLMWLNDYHIDGIRIDGVASMLYLDYGKQPG
TWTPNMYGGNENLDAIEFLKTMNKCIAKRGDGCFTIAEESSGWFGVTAADNDDPLMFTYK
QNNCWTKDFLEFMGTDPLFRKGEYDKLTYGMLYNYGEDFMLSLNHDDFRQKAFVDMVSGS
DEKAHLSDIKAALGFMYAHPGSKMFAAGQDAGLEKFMSELNKFYVKNAALYELDNDPDGF
MWLENSNPEETVIAMQRADSKGNKLVIAVNFTPVRRENYRLHVDVRGKYKEVFNSEWKKF
GGDEKVNGQIIKSDNDGDDMEYIDITLPGLSFVIYNSEPYTQLELEEIAVLKRAAIAKKE
AMRKAAEAEMLELAAAEEAKRAVEARKQAEKACMEALQAKEEAVRKAEEAARASEEIDIE
TKKKLEQLKKKMK
Download sequence
Identical sequences C4Z572
gi|238916706|ref|YP_002930223.1| 515620.EUBELI_00768 WP_012739012.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]