SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916739|ref|YP_002930256.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916739|ref|YP_002930256.1|
Domain Number 1 Region: 186-501
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.38e-33
Family Extended AAA-ATPase domain 0.021
Further Details:      
 
Domain Number 2 Region: 6-163
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.97e-33
Family ATP-dependent protease Lon (La), catalytic domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238916739|ref|YP_002930256.1|
Sequence length 510
Comment magnesium chelatase family protein [Eubacterium eligens ATCC 27750]
Sequence
MSGVLHGIKAQIVRVEVDVGNGIPSFDMSGFLSNEVKEARERVRVAIRNSGYELPPQRIA
VNISPADIRKCGTGFDLPIALAILSANGYIDEVNLDNMMILGELSLDGSINGVRGVLPCV
CSAKEAGIDKVLLPEVNINEGNIVKKISVMTAANLKQAVKYINEGIASHRSTTNDENNYK
ADMKNPEMDYSDIKGQFAAKRATMIAVAGMHNIMYMGPPGSGKTMMAKRIPTIMPEMTFD
EKLAVTNIYSVAGQLGDNGGLMEDRPFRAPYHNVTKGAFFGGGIVPRPGEITLAGKGVLF
LDEMTEFKPDILEGLRQPLEDKNITIVRMNRAYTYPADFMLVGAMNPCKCGYFPDRNRCN
CFEQDIKRFMGKISMPLWDRFDMCIKTEEIGYSELGNKIHQNDGEELNSFSMKEHIMKAR
TTQLERFKGMDIMYNSQMNGRNINKFCRLGDEESKLIEKIFAKKKLTARGYHKILKTART
IADIEGNEYITTSNISEAFYYRGIPEITVH
Download sequence
Identical sequences C4Z5F0
gi|238916739|ref|YP_002930256.1| WP_012739045.1.74791 515620.EUBELI_00801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]