SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916793|ref|YP_002930310.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916793|ref|YP_002930310.1|
Domain Number 1 Region: 472-927
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.02e-95
Family DnaQ-like 3'-5' exonuclease 0.00069
Further Details:      
 
Domain Number 2 Region: 275-355
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000548
Family Single strand DNA-binding domain, SSB 0.023
Further Details:      
 
Weak hits

Sequence:  gi|238916793|ref|YP_002930310.1|
Domain Number - Region: 388-457
Classification Level Classification E-value
Superfamily PHP domain-like 0.00392
Family PHP domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238916793|ref|YP_002930310.1|
Sequence length 1513
Comment DNA polymerase III subunit alpha [Eubacterium eligens ATCC 27750]
Sequence
MIHMYRFFEVFKTLKLPEDLAVYFENVEVTKVSKTSTNSLARVYIKSDRVIEKPIIFKVE
DALKKQIFRISNMDVRIIDRYVLSAQYTPQTVMDIYYDSILAELEKYWTLEYNLLKNSKW
EFEKEDMLVFTIEDSFLAHQYADTLTDYFKKIFLNRFGFEIDVEYQYAKKKESQYERENA
YRINLRVKEIENNMMAAAEDNADGRDDKKLTSEQKAAKKAETAAKQKAARAAFFASDNRG
REELKTYSRKPANEDVLYGRDFDGDVTPIEQIDTAIGDVIISGMVRNVEMREIRNERTII
MFNVTDFTDTITVKVFAKNEQVPELSSVIKKGNFLKIKGNATFDKYDQEISIANVWGIRK
GSDTRQVRNDLALHKRVELHCHTKMSDMDGVSYVSDIIKQAIRWGHKAIAITDHGVVQAF
TDAFHTMSDLKGSYAKKGEKLDFKIIYGVEAYLVDDTKQIVTNPRGQSFNDTYVVFDLET
TGFSAEVDRIIEIGAVKVCNGEIVDRFSTFVNPEIPIPFRIETLTHINDQMVMNAPKIEE
ILPEFLEFCEGAVMVAHNAEFDTSFIINKAEKIGINVDTTIIDTVLLAQFLMPNLHNYKL
DTLTKHLNVVLESHHRAVDDAAATADIFVKMIKMLYDRDIPDVDKLNEEGKMDENAIKKL
HQYHCIILASNEMGRINLYRLVSASHLQYFNRFPKIPKSLVNQYREGLIIGSACEAGELF
RSLVNGRSEAEIARIVNFYDYLEIQPIGNNRFMIEKEDCYVQNEEDLRNLNRRIVELGDK
FGKPVVATCDVHFLNPEDEVYRRIIMAGKGFDDADNQAPLYLHTTEEMLHECDYLGSDKA
YEVVVTNTNKIMDMCEEIEPVRPDKCPPFIENSDQMLRTICENRAHEIYGPELPQIVTER
LERELNSIISNGYSVMYIIAQKLVWKSNDDGYLVGSRGSVGSSLAATMAGITEVNPLSPH
YLCPKCYYNDFYSDEVKAFAGGAGCDMPDKICPKCGAKLNKMGFDIPFETFLGFKGNKEP
DIDLNFSNEYQSKAHAYTEVIFGKGQTFKAGTIGTVAEKTAYGFVMKYFEEKSAKNALEG
KPPIVKRKCEIERIAEGCIDIRRTTGQHPGGIVVLPIGEEIHSFTPVQHPANDMTTSIVT
THFDYHSIDHNLLKLDILGHLDPTMIRMLQDLTGIDPLEIPLDSKEVMSLFQNTSALGIK
PEDIGGTKLGALGIPEFGTDFAMQMLMDTKPQYFSDLVRIAGLAHGTDVWLGNAQTLIKE
GKATISTAICTRDDIMIYLIQKGLDSEESFKIMEMVRKGKVASGKCKEWPEWKQDMIDHG
VPDWYIWSCERIKYMFPKAHAAAYVMMAWRVAYCKVFYPLAYYTAYFSIRATAFDYEKMA
MSPVRLEHYIAEYKAKKAEGTISNTEEDELGVMRIVQEMHARGYEFTPIDIYKAKARTFQ
IIDGKIMPSFKVISKVGEVAGESIEIAARDGEFLSKDDLRQRAKIGQSAIDKLSELGILG
DMTDSNQLSLFDL
Download sequence
Identical sequences C4Z5K4
gi|238916793|ref|YP_002930310.1| WP_012739099.1.74791 515620.EUBELI_00855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]