SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|238916822|ref|YP_002930339.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916822|ref|YP_002930339.1|
Domain Number 1 Region: 6-85
Classification Level Classification E-value
Superfamily YhbC-like, N-terminal domain 1.96e-25
Family YhbC-like, N-terminal domain 0.00057
Further Details:      
 
Domain Number 2 Region: 87-154
Classification Level Classification E-value
Superfamily YhbC-like, C-terminal domain 0.00000000000000144
Family YhbC-like, C-terminal domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238916822|ref|YP_002930339.1|
Sequence length 156
Comment hypothetical protein EUBELI_00890 [Eubacterium eligens ATCC 27750]
Sequence
MGKRESYEAKTTELIQPVVEANGVELFDVDYVKEGSDWYLRVYIDKEGGVTIDDCQNVSR
AFNEILDRENYIDDQYIFEVSSPGLTRPLKKEKDYEKSIGRMIEIKLFSPVDKSKEYSGV
LKEYDKDTVTISIDDVTKTFDRSNLAMIRWAFVDEV
Download sequence
Identical sequences A0A174YQV9 C4Z5N3 R5ZIR9
gi|238916822|ref|YP_002930339.1| 515620.EUBELI_00890 WP_012739128.1.40640 WP_012739128.1.74791 WP_012739128.1.89035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]