SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916823|ref|YP_002930340.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916823|ref|YP_002930340.1|
Domain Number 1 Region: 1-137
Classification Level Classification E-value
Superfamily Transcription factor NusA, N-terminal domain 1.29e-30
Family Transcription factor NusA, N-terminal domain 0.00013
Further Details:      
 
Domain Number 2 Region: 215-290
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 2.09e-27
Family Prokaryotic type KH domain (KH-domain type II) 0.00016
Further Details:      
 
Domain Number 3 Region: 293-355
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.0000000000000118
Family Prokaryotic type KH domain (KH-domain type II) 0.00032
Further Details:      
 
Domain Number 4 Region: 139-212
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000237
Family Cold shock DNA-binding domain-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238916823|ref|YP_002930340.1|
Sequence length 381
Comment N utilization substance protein A [Eubacterium eligens ATCC 27750]
Sequence
MNKELIMALDALEKENGIDKEIMFAAIEKSLMDEYKAEFDKADNGRVELDRRTGDFHIYS
DRTVVEEVIVPENRENKKEKYVSGTDIALEDARKIKPDCQLGDVITVEVKSEEFSRKAAK
NAKNTIVQTIREQEKNALYNEYHSKEKELITGIVQRVADNGDLTIDLGRLQTVLKADDKF
KDKKFVPGDRIKLYVVDVINREKGGPVVRVSRKSQELVKKLFEEEVTEIKDGVVEIMGIA
REAGSRTKMAVRANVANVDPVGACVGINGARVKAIVNELGNEQIDIIEWDSNSAQLIVNA
LSPAKVVSAVADDEEKKAKIVVSEQQLSLAIGKQGQNVRLAAKLTGYGIDIKSEAEPEEH
TEEENLEEEYVEPSELSLDEE
Download sequence
Identical sequences C4Z5N4
WP_012739129.1.74791 515620.EUBELI_00891 gi|238916823|ref|YP_002930340.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]