SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916873|ref|YP_002930390.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916873|ref|YP_002930390.1|
Domain Number 1 Region: 65-132
Classification Level Classification E-value
Superfamily RuvA domain 2-like 6.12e-18
Family DNA helicase RuvA subunit, middle domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1-63
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000114
Family DNA helicase RuvA subunit, N-terminal domain 0.0022
Further Details:      
 
Domain Number 3 Region: 161-206
Classification Level Classification E-value
Superfamily DNA helicase RuvA subunit, C-terminal domain 0.0000000051
Family DNA helicase RuvA subunit, C-terminal domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238916873|ref|YP_002930390.1|
Sequence length 207
Comment Holliday junction DNA helicase RuvA [Eubacterium eligens ATCC 27750]
Sequence
MISYIKGELAEILPDVIVVEANGIGYNIYVPGSVPGELPSVGSEVKIYTYMNVKEDECSL
FGFLTRDDLSMFKMLICVNGIGPKAALGALSNITADDLRFAVLADDVAAIKALPGIGPKT
AQKIIIELKDKLKLDEVFESALSKNKKADNNSNVSNVMMIRNDAVEALVSLGYSSKDALV
AVKEVEDIENKDSETVLKEALKKLVKF
Download sequence
Identical sequences C4Z030
WP_012739179.1.74791 515620.EUBELI_00942 gi|238916873|ref|YP_002930390.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]