SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916875|ref|YP_002930392.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916875|ref|YP_002930392.1|
Domain Number 1 Region: 8-89
Classification Level Classification E-value
Superfamily Cell division protein ZapA-like 0.000000484
Family Cell division protein ZapA-like 0.0067
Further Details:      
 
Weak hits

Sequence:  gi|238916875|ref|YP_002930392.1|
Domain Number - Region: 79-133
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00837
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238916875|ref|YP_002930392.1|
Sequence length 135
Comment hypothetical protein EUBELI_00944 [Eubacterium eligens ATCC 27750]
Sequence
MSSKNTAEVILGGKVIKLGGYESEEYLQRVASYINNKITEFNKEESYRRMSAELRTDMMY
LNIADDYFKAKKMADSLSLDIENKDKEIYDLKHELIAAQIKAESSAKEIKELKSEINKYQ
KNIVKLETELNDSKK
Download sequence
Identical sequences A0A174Z651 C4Z032 R5ZKR4
gi|238916875|ref|YP_002930392.1| APC21094 515620.EUBELI_00944 WP_012739181.1.40640 WP_012739181.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]