SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916952|ref|YP_002930469.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916952|ref|YP_002930469.1|
Domain Number 1 Region: 93-183
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.17e-34
Family Imidazole glycerol phosphate dehydratase 0.0000795
Further Details:      
 
Domain Number 2 Region: 7-90
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.04e-32
Family Imidazole glycerol phosphate dehydratase 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238916952|ref|YP_002930469.1|
Sequence length 199
Comment imidazoleglycerol-phosphate dehydratase [Eubacterium eligens ATCC 27750]
Sequence
MAVSEIRQATVKRKTSETDIALFLRIDGSGEAEVDTGIGFFDHMLKSFAKHGLFDLKLKV
TGDLIVDCHHTIEDVGIVLGEAIKEAIGDKMSIRRYGDIILPMDETLIMCAIDLSGRPYL
GFESTFTADSVGYFDTQMVKEFFYAISYSAGMNLHIRKIAGENDHHIIEGMFKAFAKALD
EATVKDTRIKTILSTKGSL
Download sequence
Identical sequences A0A174YXG4 C4Z0A9 R6AEI7
gi|238916952|ref|YP_002930469.1| WP_012739257.1.40640 WP_012739257.1.74791 515620.EUBELI_01021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]