SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916980|ref|YP_002930497.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916980|ref|YP_002930497.1|
Domain Number 1 Region: 1-115
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.31e-45
Family Ribosomal protein L19 0.0000652
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238916980|ref|YP_002930497.1|
Sequence length 115
Comment 50S ribosomal protein L19 [Eubacterium eligens ATCC 27750]
Sequence
MNTIIKNIEDAQLKAQAPEFRVGDTVRVSAKIKEGNRERIQVFEGTVLKKQGTGVRATFT
VRKISNGVGVEKTWPLHSPIVEKVEVVRRGKARRAKLNYLRQRTGKAAKVKELVR
Download sequence
Identical sequences A0A174YZY2 C4Z0D7 R5ZL82
515620.EUBELI_01049 WP_012739285.1.40640 WP_012739285.1.74791 WP_012739285.1.89035 gi|238916980|ref|YP_002930497.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]