SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917031|ref|YP_002930548.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917031|ref|YP_002930548.1|
Domain Number 1 Region: 15-250
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 6.43e-30
Family NodB-like polysaccharide deacetylase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238917031|ref|YP_002930548.1|
Sequence length 294
Comment hypothetical protein EUBELI_01101 [Eubacterium eligens ATCC 27750]
Sequence
METIIMNKVYKVFPGGKFKVLTFSYDDGKLEDRRLVKLFNKYNLKATFNLDTGIIDPAIR
IPQEEWPELYKGHDIAVHTFTHPTMIRLNDYAALKEILEDKVNLEKIFNRPIYGLAYPNG
SYDSRIVDIAKSVGIKYARVTNDKYAATKAAEAYAANADGPILIGDENGFSMPEDYMRWV
PTCHHNHNLIDFGKKFMALTKKQYLYMMYVWGHSFEFERNNNWEIIEEFCEMIANRDDIW
YATNSDIVEYNELFDRLEFFADNEYVHNPSVKSVWLAVNNSTIVEVKGGETVKL
Download sequence
Identical sequences C4Z0I8
gi|238917031|ref|YP_002930548.1| 515620.EUBELI_01101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]