SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917043|ref|YP_002930560.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917043|ref|YP_002930560.1|
Domain Number 1 Region: 2-100,217-390
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 7.2e-72
Family DeoB catalytic domain-like 0.00000783
Further Details:      
 
Domain Number 2 Region: 100-216
Classification Level Classification E-value
Superfamily DeoB insert domain-like 2.09e-48
Family DeoB insert domain-like 0.000075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238917043|ref|YP_002930560.1|
Sequence length 391
Comment phosphopentomutase [Eubacterium eligens ATCC 27750]
Sequence
MNINRIIWIVLDSVGIGEARDAAKFGDEGADTLGHTAEANGGLNIPNMVKLGIGNIDGAH
NLERCDNPIGCFGKMAEVSAGKDTTIGHWEMAGIYSPDPFPVYPDGFPDCIIDEFIKKTG
IPGILCNKPASGTQIIAQLGDEHVATGKPIVYTSGDSVFQIACHEDVVPVERLYEMCETA
RHILTGKNAVARVIARPFVGENGNYKRTPNRRDFSLKPSEDNILCRVCDKGLDVIGVGKI
HDIFAGVGLTESKHTNDNQDGMDVTLDYMKQDNKGIIYTNLVEFDSTWGHRRDYKGYARG
LEEFDVRLSQVLDTMKDTDMLVITADHGCDPTYKGTDHTREYVPLLVYGKCLKRGVNLGT
GDTYADIAQTLAEIFGTEPVKIGKSFLNKIM
Download sequence
Identical sequences C4Z0K0
gi|238917043|ref|YP_002930560.1| 515620.EUBELI_01113 WP_012739348.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]